Last updated: February 12, 2026
magicalkenya.com
January 2026 Traffic Stats
magicalkenya.com
Global Rank:
Worldwide
2,713,830
Country Rank:
Kenya
14,976
Reveal More Competitor Secrets for Free
- Which keywords they target
- Their most important pages
- Where their traffic comes from
- Where they get backlinks from
- How they monetize their site
magicalkenya.com Web Traffic Statistics
Get a snapshot of magicalkenya.com online performance by viewing its most critical traffic metricsSpy on your competitors’ traffic generation strategies
Identify your competitor’s top products, services, and categories
Reveal the competition’s best performing digital marketing channels
magicalkenya.com Website Traffic by Country
See the global distribution of visitors to your competitor’s website and start tapping into overlooked markets. Magicalkenya.com's core audience is located in Kenya followed by United States, and Italy.magicalkenya.com Website Traffic Journey
Learn where visitors browse before and after landing on your competitor’s site to uncover new opportunities for attracting their audience.Desktop
Jan 2026
On magicalkenya.com, visitors mainly come from google.com__Google organic (37.73% of traffic), followed by Direct (30.22%). In most cases, after visiting magicalkenya.com, users go to youtube.com and magicalkenyatravelspecialist.com.
magicalkenya.com AI Traffic
No AI traffic detected for magicalkenya.comWe couldn’t find any visits from AI platforms to this domain.Try entering a different domain or check your AI visibility to see how your brand appears across ChatGPT, Gemini, Copilot, Claude, Google AI Mode, Grok, Perplexity, and more.
Nothing found
We have no data to show.
Need help expanding your AI search visibility and brand presence? Try our AI-marketing solutions:
Semrush AI Visibility Toolkit
- Review AI brand visibility
- Compare how different platforms present you versus competitors
- Track sentiment and feature mentions over time
- Identify emerging market gaps
- Discover the exact questions users ask
- Get AI-generated tips to improve your product, marketing, and market position
Semrush Enterprise AIO
- Monitor every mention in real time across ChatGPT, Perplexity, Gemini, Google AI Mode, Claude, Grok, and other AI search platforms
- Filter insights from brand to product or prompt level
- Benchmark visibility and perception against competitors
- Show how your products appear in ChatGPT Shopping
- Deliver customizable reports and expert support help you protect your narrative and turn AI visibility into measurable growth
magicalkenya.com Backlink Analytics
Analyze and track magicalkenya.com’s backlink profile with the fastest backlink database availableDiscover the most valuable backlink portfolio in your niche
Spot toxic links and remove them before they cause harm to your website
Find your strongest competitors for backlinks
magicalkenya.com SEO Audit
Check out magicalkenya.com’s site performance with an audit that detects issues related to crawlability, content, links, and codingAssess your website’s performance and fix all associated issues
Make sure Google bot can crawl and index your website
Scan your website for 130+ technical and SEO mistakes